Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rnls Rabbit Polyclonal Antibody (Biotin)

Rnls Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AI452315, AW060440, C10orf59, 6530404N21Rik

UniProt

A7RDN6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GMKIGVPWSCRYLSSHPCICFISIDNKKRNIESSECGPSVVIQTTVPFGV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001161290

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HES7/Transcription factor HES-7 ELISA Kit
MBS2907489-01 48 Well

Human HES7/Transcription factor HES-7 ELISA Kit

Sign In for Pricing
View Details
Human HES7/Transcription factor HES-7 ELISA Kit
MBS2907489-02 96 Well

Human HES7/Transcription factor HES-7 ELISA Kit

Sign In for Pricing
View Details
Human HES7/Transcription factor HES-7 ELISA Kit
MBS2907489-03 5x 96 Well

Human HES7/Transcription factor HES-7 ELISA Kit

Sign In for Pricing
View Details
Human HES7/Transcription factor HES-7 ELISA Kit
MBS2907489-04 10x 96 Well

Human HES7/Transcription factor HES-7 ELISA Kit

Sign In for Pricing
View Details
Lentiviral human RAB31 shRNA (UAS) - Lentiviral human RAB31 shRNA (UAS) (25)
GTR15308600 1 Vial

Lentiviral human RAB31 shRNA (UAS) - Lentiviral human RAB31 shRNA (UAS) (25)

Sign In for Pricing
View Details
CD83 Rabbit Polyclonal Antibody (BF555)
orb1576463 100 µL

CD83 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details