Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rnls Rabbit Polyclonal Antibody (FITC)

Rnls Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AI452315, AW060440, C10orf59, 6530404N21Rik

UniProt

A7RDN6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GMKIGVPWSCRYLSSHPCICFISIDNKKRNIESSECGPSVVIQTTVPFGV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001161290

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ankrd13a siRNA Oligos set (Mouse)
11932174 3x 5 nmol

Ankrd13a siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Mouse Snph Pre-designed siRNA Set A
SI113502A 1 Each

Mouse Snph Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-IEEV membrane glycoprotein B6R [Monkeypox virus]
IT-012-017M4-01 0.1 mg

Anti-IEEV membrane glycoprotein B6R [Monkeypox virus]

Sign In for Pricing
View Details
Anti-IEEV membrane glycoprotein B6R [Monkeypox virus]
IT-012-017M4-02 0.5 mg

Anti-IEEV membrane glycoprotein B6R [Monkeypox virus]

Sign In for Pricing
View Details
EXOC3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
19560124 3x 1.0µg DNA

EXOC3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Argonaute-2 Polyclonal Antibody
MBS2572453-01 0.06 mL

Argonaute-2 Polyclonal Antibody

Sign In for Pricing
View Details