Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGR5 Rabbit Polyclonal Antibody (Biotin)

LGR5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FEX, HG38, GPR49, GPR67, GRP49

UniProt

O75473

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

100 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC

NCBI Accession Number

NP_003658

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Etelcalcetide Impurity 21
RM-E159021-01 10 mg

Etelcalcetide Impurity 21

Sign In for Pricing
View Details
Etelcalcetide Impurity 21
RM-E159021-02 100 mg

Etelcalcetide Impurity 21

Sign In for Pricing
View Details
Etelcalcetide Impurity 21
RM-E159021-03 25 mg

Etelcalcetide Impurity 21

Sign In for Pricing
View Details
Etelcalcetide Impurity 21
RM-E159021-04 50 mg

Etelcalcetide Impurity 21

Sign In for Pricing
View Details
Anti-TRIM47 Antibody Picoband® Fluoro647 Conjugated
A12382-1-Fluoro647 100 µg/Vial

Anti-TRIM47 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Carbonic Anhydrase IX Recombinant Protein His Tag Lyophilized
MBS8430709-01 0.05 mg

Carbonic Anhydrase IX Recombinant Protein His Tag Lyophilized

Sign In for Pricing
View Details