Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGR5 Rabbit Polyclonal Antibody (HRP)

LGR5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FEX, HG38, GPR49, GPR67, GRP49

UniProt

O75473

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

100 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC

NCBI Accession Number

NP_003658

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella Boydii hemA Protein (aa 1-418) (strain Sb227)
VAng-Lsx09155-50gEcoli 50 µg (E. coli)

Recombinant Shigella Boydii hemA Protein (aa 1-418) (strain Sb227)

Sign In for Pricing
View Details
MED10 Rabbit pAb, AE conjugated
orb2857266 100 µL

MED10 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
Mouse Nuclear factor erythroid 2-related factor 3 (NFE2L3) ELISA Kit
orb1669120-01 48 Tests

Mouse Nuclear factor erythroid 2-related factor 3 (NFE2L3) ELISA Kit

Sign In for Pricing
View Details
Mouse Nuclear factor erythroid 2-related factor 3 (NFE2L3) ELISA Kit
orb1669120-02 96 Tests

Mouse Nuclear factor erythroid 2-related factor 3 (NFE2L3) ELISA Kit

Sign In for Pricing
View Details
(2-Cyclopentylethyl) amine
OR322275 1 Each

(2-Cyclopentylethyl) amine

Sign In for Pricing
View Details
DCX Polyclonal Antibody
MBS8572050-01 0.1 mL

DCX Polyclonal Antibody

Sign In for Pricing
View Details