Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGR5 Rabbit Polyclonal Antibody (HRP)

LGR5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FEX, HG38, GPR49, GPR67, GRP49

UniProt

O75473

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

100 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC

NCBI Accession Number

NP_003658

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EDNRB Antibody
orb107505 100 µL

EDNRB Antibody

Sign In for Pricing
View Details
HA1 (ARHGAP45) (NM_012292) Human Tagged Lenti ORF Clone
RC209595L3 10 µg

HA1 (ARHGAP45) (NM_012292) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Atg9b CRISPR Activation Plasmid (m)
sc-431901-ACT 20 µg

Atg9b CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
ODC1 Antibody Blocking peptide
orb1456516 500 µg

ODC1 Antibody Blocking peptide

Sign In for Pricing
View Details
Recombinant Vibrio splendidus 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)
MBS1119473-01 0.02 mg (E-Coli)

Recombinant Vibrio splendidus 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)

Sign In for Pricing
View Details
Recombinant Vibrio splendidus 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)
MBS1119473-02 0.02 mg (Yeast)

Recombinant Vibrio splendidus 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)

Sign In for Pricing
View Details