Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rassf5 Rabbit Polyclonal Antibody (FITC)

Rassf5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

No, Nor, Rapl, Maxp1, Nore1, Nore1A, Nore1B, 1300019G20Rik

UniProt

Q5EBH1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rassf5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQK

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061220

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGED1 (Melanoma-associated Antigen D1, MAGE-D1 Antigen, Neurotrophin Receptor-interacting MAGE Homolog, MAGE Tumor Antigen CCF, NRAGE, PRO2292, PP2250) (MaxLight 490)
129325-ML490 100 µL

MAGED1 (Melanoma-associated Antigen D1, MAGE-D1 Antigen, Neurotrophin Receptor-interacting MAGE Homolog, MAGE Tumor Antigen CCF, NRAGE, PRO2292, PP2250) (MaxLight 490)

Sign In for Pricing
View Details
KRT14 (Keratin, Type I Cytoskeletal 14, Cytokeratin-14, CK-14, Keratin-14, K14) (HRP)
128932-HRP 100 µL

KRT14 (Keratin, Type I Cytoskeletal 14, Cytokeratin-14, CK-14, Keratin-14, K14) (HRP)

Sign In for Pricing
View Details
Zebrafish NQO1 Rabbit Polyclonal Antibody (Cy3)
orb3002877 100 µg

Zebrafish NQO1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
MED21 Antibody Blocking Peptide
orb1513766 500 µg

MED21 Antibody Blocking Peptide

Sign In for Pricing
View Details
CYLD Antibody [D11C7]
C21748-20ul 20 µL

CYLD Antibody [D11C7]

Sign In for Pricing
View Details
Rabbit Polyclonal POLR3E Antibody [DyLight 755]
NBP2-97859IR 0.1 mL

Rabbit Polyclonal POLR3E Antibody [DyLight 755]

Sign In for Pricing
View Details