Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rassf5 Rabbit Polyclonal Antibody (HRP)

Rassf5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

No, Nor, Rapl, Maxp1, Nore1, Nore1A, Nore1B, 1300019G20Rik

UniProt

Q5EBH1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rassf5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQK

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061220

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Wee1 (Ser642) Antibody [P3A10]
C18959-50uL 50 μL

Phospho-Wee1 (Ser642) Antibody [P3A10]

Sign In for Pricing
View Details
RFFL (NM_057178) Human Over-expression Lysate
LS117584-20ug 20 µg

RFFL (NM_057178) Human Over-expression Lysate

Sign In for Pricing
View Details
Zebrafish LEO1 Rabbit Polyclonal Antibody (APC)
orb2817468 100 µg

Zebrafish LEO1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
CD51 Antibody / Integrin alpha V / ITGAV / Vitronectin Receptor
RQ7113 100 µg

CD51 Antibody / Integrin alpha V / ITGAV / Vitronectin Receptor

Sign In for Pricing
View Details
DPP6 Rabbit Polyclonal Antibody (APC-Cy7)
orb2380228 100 µL

DPP6 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Stefin B BioAssayTM ELISA Kit
473728 96 Tests

Stefin B BioAssayTM ELISA Kit

Sign In for Pricing
View Details