Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASSF1 Rabbit Polyclonal Antibody (HRP)

RASSF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

123F2, RDA32, NORE2A, RASSF1A, REH3P21

UniProt

Q9NS23

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RASSF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LAGPSDKALSFVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQIL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_733831

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Uqcrq shRNA (UAS) - Lentiviral mouse Uqcrq shRNA (UAS, GFP) plasmid
GTR15222010 1 Vial

Lentiviral mouse Uqcrq shRNA (UAS) - Lentiviral mouse Uqcrq shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
CD82 (Kangai 1, R2, 4F9, C33, IA4, ST6, GR15, KAI1, SAR2, TSPAN27, R2 Leukocyte Antigen, Suppression of Tumorigenicity 6) (HRP)
MBS6410484-01 0.1 mL

CD82 (Kangai 1, R2, 4F9, C33, IA4, ST6, GR15, KAI1, SAR2, TSPAN27, R2 Leukocyte Antigen, Suppression of Tumorigenicity 6) (HRP)

Sign In for Pricing
View Details
CD82 (Kangai 1, R2, 4F9, C33, IA4, ST6, GR15, KAI1, SAR2, TSPAN27, R2 Leukocyte Antigen, Suppression of Tumorigenicity 6) (HRP)
MBS6410484-02 5x 0.1 mL

CD82 (Kangai 1, R2, 4F9, C33, IA4, ST6, GR15, KAI1, SAR2, TSPAN27, R2 Leukocyte Antigen, Suppression of Tumorigenicity 6) (HRP)

Sign In for Pricing
View Details
Qualitative Filter Papers, Grade 6, Slow, 3um, 600mm, 100pcs/pk
22012067 100 PCS

Qualitative Filter Papers, Grade 6, Slow, 3um, 600mm, 100pcs/pk

Sign In for Pricing
View Details
C1orf182-set siRNA/shRNA/RNAi Lentivector (Human)
14167091 4x 500 ng

C1orf182-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Human N-Methylpurine DNA Glycosylase (MPG) ELISA Kit
BSKH63862-01 48 Tests

Human N-Methylpurine DNA Glycosylase (MPG) ELISA Kit

Sign In for Pricing
View Details