Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RERG Rabbit Polyclonal Antibody (FITC)

RERG Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MGC15754

UniProt

Q96A58

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RERG

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CAFYECSACTGEGNITEIFYELCREVRRRRMVQGKTRRRSSTTHVKQAIN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_116307

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Insulin-like growth factor I protein (IGF1) (Active)
orb1650682-01 20 µg

Recombinant Human Insulin-like growth factor I protein (IGF1) (Active)

Sign In for Pricing
View Details
Recombinant Human Insulin-like growth factor I protein (IGF1) (Active)
orb1650682-02 100 µg

Recombinant Human Insulin-like growth factor I protein (IGF1) (Active)

Sign In for Pricing
View Details
Recombinant Human Insulin-like growth factor I protein (IGF1) (Active)
orb1650682-03 1 mg

Recombinant Human Insulin-like growth factor I protein (IGF1) (Active)

Sign In for Pricing
View Details
Mcpt4 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
28247124 3x 1.0µg DNA

Mcpt4 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Human Dedicator of Cytokinesis 3 ELISA Kit
MBS081080-01 48 Well

Human Dedicator of Cytokinesis 3 ELISA Kit

Sign In for Pricing
View Details
Human Dedicator of Cytokinesis 3 ELISA Kit
MBS081080-02 96 Well

Human Dedicator of Cytokinesis 3 ELISA Kit

Sign In for Pricing
View Details