Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rerg Rabbit Polyclonal Antibody (Biotin)

Rerg Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RGD1562829

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NILDEIKKPKNVTLILVGNKADLDHSRQVSTEEGEKLASELACAFYECSA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_001072746

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mir695 Mouse MicroRNA Expression Plasmid (MI0004675)
SC401185 10 µg

Mir695 Mouse MicroRNA Expression Plasmid (MI0004675)

Sign In for Pricing
View Details
Leptin, CT (LEP, Obesity Factor, Obese Protein, OB, OBS)
L1670-21C 200 µL

Leptin, CT (LEP, Obesity Factor, Obese Protein, OB, OBS)

Sign In for Pricing
View Details
GINS2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
21520064 1.0 µg DNA

GINS2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
W/W028/NL260/TWM-297X105-1 Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)
237386 1 Pack (1 Panel (s) x 1 Pack)

W/W028/NL260/TWM-297X105-1 Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)

Sign In for Pricing
View Details
ACPT discontinued
506490 100 µg

ACPT discontinued

Sign In for Pricing
View Details
Kinesis Inline MicroFilter Assy 1um SS
CHR3611 1 Each

Kinesis Inline MicroFilter Assy 1um SS

Sign In for Pricing
View Details