Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rerg Rabbit Polyclonal Antibody (HRP)

Rerg Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1562829

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NILDEIKKPKNVTLILVGNKADLDHSRQVSTEEGEKLASELACAFYECSA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_001072746

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCGF3 Human Recombinant Protein
TP726027 50 µg

PCGF3 Human Recombinant Protein

Sign In for Pricing
View Details
Olr960 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7605303 1.0 µg DNA

Olr960 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Polyclonal Antibody to Enolase, Non Neuronal (NNE)
MBS2004811-01 0.1 mL

Polyclonal Antibody to Enolase, Non Neuronal (NNE)

Sign In for Pricing
View Details
Polyclonal Antibody to Enolase, Non Neuronal (NNE)
MBS2004811-02 0.2 mL

Polyclonal Antibody to Enolase, Non Neuronal (NNE)

Sign In for Pricing
View Details
Polyclonal Antibody to Enolase, Non Neuronal (NNE)
MBS2004811-03 0.5 mL

Polyclonal Antibody to Enolase, Non Neuronal (NNE)

Sign In for Pricing
View Details
Polyclonal Antibody to Enolase, Non Neuronal (NNE)
MBS2004811-04 1 mL

Polyclonal Antibody to Enolase, Non Neuronal (NNE)

Sign In for Pricing
View Details