Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1C1 Rabbit Polyclonal Antibody (Biotin)

OR1C1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OR1-42, ORL211, TPCR27, HSTPCR27, OR1.5.10

UniProt

Q15619

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of mouse OR1C1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SVIYVYFRPLSMYSVVKDRIATVMYTVVTPMMNPFIYSLRNKDMKRGLRK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036485.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH1A1 (Aldehyde Dehydrogenase 1 Family, Member A1, ALDH Class 1, ALDC, ALDH-E1, ALDH1, ALDH11, MGC2318, PUMB1, RALDH1) (MaxLight 405) discontinued
207483-ML405 100 µL

ALDH1A1 (Aldehyde Dehydrogenase 1 Family, Member A1, ALDH Class 1, ALDC, ALDH-E1, ALDH1, ALDH11, MGC2318, PUMB1, RALDH1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
MAP2K1IP1 Protein Vector (Rat) (pPB-C-His)
PV280930 500 ng

MAP2K1IP1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
BFAR, Control Peptide (Bifunctional Apoptosis Regulator, RING Finger Protein 47, BAR, RNF47)
149371 50 µg

BFAR, Control Peptide (Bifunctional Apoptosis Regulator, RING Finger Protein 47, BAR, RNF47)

Sign In for Pricing
View Details
SOCS1 antibody - N-terminal region
MBS3206216-01 0.1 mL

SOCS1 antibody - N-terminal region

Sign In for Pricing
View Details
SOCS1 antibody - N-terminal region
MBS3206216-02 5x 0.1 mL

SOCS1 antibody - N-terminal region

Sign In for Pricing
View Details
Recombinant Mouse c-kit / CD117 Protein (Fc tag) (Fc tag)
ARP7479-01 10 µg

Recombinant Mouse c-kit / CD117 Protein (Fc tag) (Fc tag)

Sign In for Pricing
View Details