Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1D2 Rabbit Polyclonal Antibody (FITC)

OR1D2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OLFR1, OR17-4

UniProt

P34982

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OR1D2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LHTYSVKDSVATVMYAVVTPMMNPFIYSLRNKDMHGALGRLLDKHFKRLT

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_002539

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF321 shRNA Plasmid (h)
sc-97306-SH 20 µg

ZNF321 shRNA Plasmid (h)

Sign In for Pricing
View Details
KDM2B, NT (Lysine-specific Demethylase 2B, JmjC Domain-containing Histone Demethylation Protein 1B, [Histone-H3]-lysine-36 Demethylase 1B, F-box/LRR-repeat Protein 10, F-box and Leucine-rich Repeat Protein 10, F-box Protein FBL10, Protein JEMMA, Jumonji Domain-containing EMSY-interactor Methyltransferase Motif Protein, CXXC-type Zinc Finger Protein 2, Protein-containing CXXC Domain 2, CXXC2, FBL10, JHDM1B, PCCX2, JHDM1b, FBXL10) (Azide free) (HRP) discontinued
K0138-40B-HRP 200 µL

KDM2B, NT (Lysine-specific Demethylase 2B, JmjC Domain-containing Histone Demethylation Protein 1B, [Histone-H3]-lysine-36 Demethylase 1B, F-box/LRR-repeat Protein 10, F-box and Leucine-rich Repeat Protein 10, F-box Protein FBL10, Protein JEMMA, Jumonji Domain-containing EMSY-interactor Methyltransferase Motif Protein, CXXC-type Zinc Finger Protein 2, Protein-containing CXXC Domain 2, CXXC2, FBL10, JHDM1B, PCCX2, JHDM1b, FBXL10) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Recombinant Pan troglodytes Mas-related G-protein coupled receptor member X2 (MRGPRX2)
orb2905897-01 20 µg

Recombinant Pan troglodytes Mas-related G-protein coupled receptor member X2 (MRGPRX2)

Sign In for Pricing
View Details
Recombinant Pan troglodytes Mas-related G-protein coupled receptor member X2 (MRGPRX2)
orb2905897-02 100 µg

Recombinant Pan troglodytes Mas-related G-protein coupled receptor member X2 (MRGPRX2)

Sign In for Pricing
View Details
EXOC5 Protein Vector (Rat) (pPM-C-HA)
19566026 500 ng

EXOC5 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
TCP-1 β Lentiviral Activation Particles (m)
sc-419523-LAC 200 µL

TCP-1 β Lentiviral Activation Particles (m)

Sign In for Pricing
View Details