Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1J1 Rabbit Polyclonal Antibody (HRP)

OR1J1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hg32, OR9-18

UniProt

Q8NGS3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OR1J1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TKGICKALSTCGSHLSVVTIYYRTIIGLYFLPPSSNTNDKNIIASVIYTA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004451

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inositol-Trisphosphate 3-Kinase A (ITPKA) Antibody
abx124347-01 100 µL

Inositol-Trisphosphate 3-Kinase A (ITPKA) Antibody

Sign In for Pricing
View Details
Inositol-Trisphosphate 3-Kinase A (ITPKA) Antibody
abx124347-02 200 µL

Inositol-Trisphosphate 3-Kinase A (ITPKA) Antibody

Sign In for Pricing
View Details
Sheep Olfactory receptor 13A1 (OR13A1) ELISA Kit
OM618869 96 Strip Well

Sheep Olfactory receptor 13A1 (OR13A1) ELISA Kit

Sign In for Pricing
View Details
Rat Shq1 Pre-designed siRNA Set A
SI212849A 1 Each

Rat Shq1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
GAPDH Rabbit Polyclonal Antibody (FITC)
orb2126157 100 µL

GAPDH Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
TMEM190 Human shRNA Lentiviral Particle (Locus ID 147744)
TL319184V 500 µL Each

TMEM190 Human shRNA Lentiviral Particle (Locus ID 147744)

Sign In for Pricing
View Details