Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Olfr3 Rabbit Polyclonal Antibody (Biotin)

Olfr3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Y71, MOR136-, MOR136-14

UniProt

Q60879

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Olfr3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LGALLKLSCSDTSLNQLVIFTAGLAAIMLPFLCILISYGRIGFTILQVPT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_996786

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Cadherin EGF LAG seven-pass G-type receptor 1 (CELSR1) ELISA Kit
MBS7236133-01 48 Well

Canine Cadherin EGF LAG seven-pass G-type receptor 1 (CELSR1) ELISA Kit

Sign In for Pricing
View Details
Canine Cadherin EGF LAG seven-pass G-type receptor 1 (CELSR1) ELISA Kit
MBS7236133-02 96 Well

Canine Cadherin EGF LAG seven-pass G-type receptor 1 (CELSR1) ELISA Kit

Sign In for Pricing
View Details
Canine Cadherin EGF LAG seven-pass G-type receptor 1 (CELSR1) ELISA Kit
MBS7236133-03 5x 96 Well

Canine Cadherin EGF LAG seven-pass G-type receptor 1 (CELSR1) ELISA Kit

Sign In for Pricing
View Details
Canine Cadherin EGF LAG seven-pass G-type receptor 1 (CELSR1) ELISA Kit
MBS7236133-04 10x 96 Well

Canine Cadherin EGF LAG seven-pass G-type receptor 1 (CELSR1) ELISA Kit

Sign In for Pricing
View Details
AFP (A2) mouse Monoclonal Antibody APC Conjugated
orb1539629 100 µL

AFP (A2) mouse Monoclonal Antibody APC Conjugated

Sign In for Pricing
View Details
Stil ORF Vector (Mouse) (pORF)
ORF058677 1.0 µg DNA

Stil ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details