Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1S1 Rabbit Polyclonal Antibody (Biotin)

OR1S1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OST034, OR11-232

UniProt

Q8NH92

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OR1S1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FSTCGSHLTVVLLFYGTIVGVYFFPSSTHPEDTDKIGAVLFTVVTPMINP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004458

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IC, RS 232 Receiver
2020810/Z 1 Each

IC, RS 232 Receiver

Sign In for Pricing
View Details
E4BP4 HDR Plasmid (h2)
sc-401353-HDR-2 20 µg

E4BP4 HDR Plasmid (h2)

Sign In for Pricing
View Details
SERPING1 (Plasma Protease C1 Inhibitor, C1 Inh, C1Inh, C1 Esterase Inhibitor, C1-inhibiting Factor, Serpin G1, C1IN, C1NH) (MaxLight 490)
MBS6393844-01 0.1 mL

SERPING1 (Plasma Protease C1 Inhibitor, C1 Inh, C1Inh, C1 Esterase Inhibitor, C1-inhibiting Factor, Serpin G1, C1IN, C1NH) (MaxLight 490)

Sign In for Pricing
View Details
SERPING1 (Plasma Protease C1 Inhibitor, C1 Inh, C1Inh, C1 Esterase Inhibitor, C1-inhibiting Factor, Serpin G1, C1IN, C1NH) (MaxLight 490)
MBS6393844-02 5x 0.1 mL

SERPING1 (Plasma Protease C1 Inhibitor, C1 Inh, C1Inh, C1 Esterase Inhibitor, C1-inhibiting Factor, Serpin G1, C1IN, C1NH) (MaxLight 490)

Sign In for Pricing
View Details
ACTN3 antibody
70R-49332 100 ul

ACTN3 antibody

Sign In for Pricing
View Details
Netrin 1 Antibody Western Blot Positive Control
MBS543004-01 5 Applications

Netrin 1 Antibody Western Blot Positive Control

Sign In for Pricing
View Details