Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1S1 Rabbit Polyclonal Antibody (HRP)

OR1S1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OST034, OR11-232

UniProt

Q8NGQ3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OR1S1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FPSSTHPEDTDKIGAVLFTVVTPMINPFIYSLRNKDMKGALRKLINRKIS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004458

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXD2 Human Gene Knockout Kit (CRISPR)
KN422086 1 Kit

FOXD2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/2576), CF568 conjugate, 0.1mg/mL
BNC682576-500 1x 500 µL

NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/2576), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NRF1 (NRF1/2609), CF740 conjugate, 0.1mg/mL
BNC742609-100 1x 100 µL

NRF1 (NRF1/2609), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
beta-Caryophyllene Epoxide
TRC-C184730-1G 1 g

beta-Caryophyllene Epoxide

Sign In for Pricing
View Details
Non Neuronal Enolase (ENO1) Rabbit Monoclonal Antibody [Clone ID: OTIR4F8]
TA594236 100 µL

Non Neuronal Enolase (ENO1) Rabbit Monoclonal Antibody [Clone ID: OTIR4F8]

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2416), CF568 conjugate, 0.1mg/mL
BNC682416-100 1x 100 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2416), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details