Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR1S1 Rabbit Polyclonal Antibody (HRP)

OR1S1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OST034, OR11-232

UniProt

Q8NGQ3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OR1S1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FPSSTHPEDTDKIGAVLFTVVTPMINPFIYSLRNKDMKGALRKLINRKIS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004458

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), CF488A conjugate, 0.1mg/mL
BNC882746-100 1x 100 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Colon: sigmoid
CR562598 5 µg

Tissue Total RNA, Colon: sigmoid

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1964), CF568 conjugate, 0.1mg/mL
BNC681964-100 1x 100 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1964), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Triethylammonium Sulfate
TRC-T797470-1G 1 g

Triethylammonium Sulfate

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS700699 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
PE Anti-Human CD273/PD-L2 Antibody[24F.10C12]
E-AB-F1175D-01 20 Tests

PE Anti-Human CD273/PD-L2 Antibody[24F.10C12]

Sign In for Pricing
View Details