Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2B2 Rabbit Polyclonal Antibody (Biotin)

OR2B2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OR2B9, OR6-1, OR2B2Q, hs6M1-10, dJ193B12.4

UniProt

Q9GZK3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OR2B2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IAPMLNPLIYTLRNKEVKEAFKRLVAKSLLNQEIRNMQMISFAKDTVLTY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_149046

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERBB2 (Receptor Tyrosine-protein Kinase ErbB-2, NEU, NGL, HER2, TKR1, CD340, HER-2, MLN 19, HER-2/neu) (MaxLight 550)
MBS6416108-01 0.1 mL

ERBB2 (Receptor Tyrosine-protein Kinase ErbB-2, NEU, NGL, HER2, TKR1, CD340, HER-2, MLN 19, HER-2/neu) (MaxLight 550)

Sign In for Pricing
View Details
ERBB2 (Receptor Tyrosine-protein Kinase ErbB-2, NEU, NGL, HER2, TKR1, CD340, HER-2, MLN 19, HER-2/neu) (MaxLight 550)
MBS6416108-02 5x 0.1 mL

ERBB2 (Receptor Tyrosine-protein Kinase ErbB-2, NEU, NGL, HER2, TKR1, CD340, HER-2, MLN 19, HER-2/neu) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Polaromonas naphthalenivorans Phosphatidylserine decarboxylase proenzyme (psd)
MBS1092181-01 0.02 mg (E-Coli)

Recombinant Polaromonas naphthalenivorans Phosphatidylserine decarboxylase proenzyme (psd)

Sign In for Pricing
View Details
Recombinant Polaromonas naphthalenivorans Phosphatidylserine decarboxylase proenzyme (psd)
MBS1092181-02 0.1 mg (E-Coli)

Recombinant Polaromonas naphthalenivorans Phosphatidylserine decarboxylase proenzyme (psd)

Sign In for Pricing
View Details
Recombinant Polaromonas naphthalenivorans Phosphatidylserine decarboxylase proenzyme (psd)
MBS1092181-03 0.02 mg (Yeast)

Recombinant Polaromonas naphthalenivorans Phosphatidylserine decarboxylase proenzyme (psd)

Sign In for Pricing
View Details
Recombinant Polaromonas naphthalenivorans Phosphatidylserine decarboxylase proenzyme (psd)
MBS1092181-04 0.1 mg (Yeast)

Recombinant Polaromonas naphthalenivorans Phosphatidylserine decarboxylase proenzyme (psd)

Sign In for Pricing
View Details