Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2C3 Rabbit Polyclonal Antibody (FITC)

OR2C3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OR2C4, OR2C5P, OST742

UniProt

Q8N628

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OR2C3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LFYGSIIFMYLQPAKSTSHEQGKFIALFYTVVTPALNPLIYTLRNTEVKS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_932340

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clec2f, Mouse (HEK293, Fc)
HY-P704629 100 µg

Clec2f, Mouse (HEK293, Fc)

Sign In for Pricing
View Details
Poly A Binding Protein Cytoplasmic 1 Like Protein (PABPC1L) Magnetic Luminex Assay Kit
LKU605994 96 Tests

Poly A Binding Protein Cytoplasmic 1 Like Protein (PABPC1L) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
TCTP Rabbit Polyclonal Antibody (Cy7)
orb1047414 100 µL

TCTP Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Tetanus toxin light chain Polyclonal Antibody HRP Conjugated
orb1541320 100 µL

Tetanus toxin light chain Polyclonal Antibody HRP Conjugated

Sign In for Pricing
View Details
Pituitary Tumor Transforming 1 (PTTG1) Antibody
abx338889-01 20 µg

Pituitary Tumor Transforming 1 (PTTG1) Antibody

Sign In for Pricing
View Details
Pituitary Tumor Transforming 1 (PTTG1) Antibody
abx338889-02 50 µg

Pituitary Tumor Transforming 1 (PTTG1) Antibody

Sign In for Pricing
View Details