Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2C3 Rabbit Polyclonal Antibody (Biotin)

OR2C3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OR2C4, OR2C5P, OST742

UniProt

Q8N628

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OR2C3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LQPAKSTSHEQGKFIALFYTVVTPALNPLIYTLRNTEVKSALRHMVLENC

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

NCBI Accession Number

NP_932340

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM52 Rabbit Polyclonal Antibody (BF647)
orb2493177 100 µL

TRIM52 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
CHRM2, ID (CHRM2, Muscarinic acetylcholine receptor M2) (MaxLight 750) discontinued
033867-ML750 100 µL

CHRM2, ID (CHRM2, Muscarinic acetylcholine receptor M2) (MaxLight 750) discontinued

Sign In for Pricing
View Details
CD163 Mouse Monoclonal Antibody
orb397159 100 µg

CD163 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Hotplate Stirrer, Digital, 550C Max Temp
GHS-550HS 1 Each

Hotplate Stirrer, Digital, 550C Max Temp

Sign In for Pricing
View Details
Human Programmed Cell Death Protein5 (PDCD5) ELISA Kit
YP-W18994-01 48 Tests

Human Programmed Cell Death Protein5 (PDCD5) ELISA Kit

Sign In for Pricing
View Details
Human Programmed Cell Death Protein5 (PDCD5) ELISA Kit
YP-W18994-02 96 Tests

Human Programmed Cell Death Protein5 (PDCD5) ELISA Kit

Sign In for Pricing
View Details