Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2C3 Rabbit Polyclonal Antibody (Biotin)

OR2C3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OR2C4, OR2C5P, OST742

UniProt

Q8N628

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OR2C3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LQPAKSTSHEQGKFIALFYTVVTPALNPLIYTLRNTEVKSALRHMVLENC

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

NCBI Accession Number

NP_932340

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Chchd2 shRNA (UAS) - Lentiviral mouse Chchd2 shRNA (UAS, GFP) (100)
GTR15220461 1 Vial

Lentiviral mouse Chchd2 shRNA (UAS) - Lentiviral mouse Chchd2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
MCU siRNA (Mouse)
orb1837297-01 15 nmol

MCU siRNA (Mouse)

Sign In for Pricing
View Details
MCU siRNA (Mouse)
orb1837297-02 30 nmol

MCU siRNA (Mouse)

Sign In for Pricing
View Details
Apilimod mesylate
B1129-5 5 mg

Apilimod mesylate

Sign In for Pricing
View Details
AT-rich interactive domain-containing protein 4A (ARID4A) Human ELISA Kit
B7035 96 Tests

AT-rich interactive domain-containing protein 4A (ARID4A) Human ELISA Kit

Sign In for Pricing
View Details
NPY Antibody
CSB-PA016034GA01HU 100 µL

NPY Antibody

Sign In for Pricing
View Details