Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Olr806 Rabbit Polyclonal Antibody (Biotin)

Olr806 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

D3ZFL4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Olr806

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IISTILKIQSKEGRKKAFHTCASHLTVVALCYGMAIFTYIQPHSSPSVLQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001000976

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARMCX3, CT (ARMCX3, ALEX3, Armadillo repeat-containing X-linked protein 3, ARM protein lost in epithelial cancers on chromosome X 3) (MaxLight 550)
MBS6275288-01 0.1 mL

ARMCX3, CT (ARMCX3, ALEX3, Armadillo repeat-containing X-linked protein 3, ARM protein lost in epithelial cancers on chromosome X 3) (MaxLight 550)

Sign In for Pricing
View Details
ARMCX3, CT (ARMCX3, ALEX3, Armadillo repeat-containing X-linked protein 3, ARM protein lost in epithelial cancers on chromosome X 3) (MaxLight 550)
MBS6275288-02 5x 0.1 mL

ARMCX3, CT (ARMCX3, ALEX3, Armadillo repeat-containing X-linked protein 3, ARM protein lost in epithelial cancers on chromosome X 3) (MaxLight 550)

Sign In for Pricing
View Details
PPP1CA Antibody
MBS9607560-01 0.1 mL

PPP1CA Antibody

Sign In for Pricing
View Details
PPP1CA Antibody
MBS9607560-02 0.2 mL

PPP1CA Antibody

Sign In for Pricing
View Details
PPP1CA Antibody
MBS9607560-03 5x 0.2 mL

PPP1CA Antibody

Sign In for Pricing
View Details
Lentiviral mouse Fli1 shRNA (UAS) - Lentiviral mouse Fli1 shRNA (UAS, GFP) (100)
GTR15190377 1 Vial

Lentiviral mouse Fli1 shRNA (UAS) - Lentiviral mouse Fli1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details