Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Olr806 Rabbit Polyclonal Antibody (HRP)

Olr806 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

D3ZFL4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Olr806

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IISTILKIQSKEGRKKAFHTCASHLTVVALCYGMAIFTYIQPHSSPSVLQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001000976

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IgG3 Fc
PKSH033894-01 10 µg

Recombinant Human IgG3 Fc

Sign In for Pricing
View Details
Recombinant Human IgG3 Fc
PKSH033894-02 50 µg

Recombinant Human IgG3 Fc

Sign In for Pricing
View Details
Fas (TNFRSF6) associated factor 1 (CPTC-FAF1-2), Biotin conjugate, 0.1mg/mL
BNCB2268-100 1x 100 µL

Fas (TNFRSF6) associated factor 1 (CPTC-FAF1-2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG507R), CF740 conjugate, 0.1mg/mL
BNC740507-500 1x 500 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG507R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse β-NGF/Beta-NGF Protein
PKSM040709 20 µg

Recombinant Mouse β-NGF/Beta-NGF Protein

Sign In for Pricing
View Details
Variable Volume 12 Channel Micropipette BPIP-330
BPIP-330 1 Unit

Variable Volume 12 Channel Micropipette BPIP-330

Sign In for Pricing
View Details