Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2G2 Rabbit Polyclonal Antibody (FITC)

OR2G2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OR1-32

UniProt

Q8NGZ5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OR2G2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VTIFYGTIIFMYLQPAKSRSRDQGKFVSLFYTVVTRMLNPLIYTLRIKEV

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

NCBI Accession Number

NP_001001915

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Shigella flexneri YECA Polyclonal Antibody
MBS7163628 Inquire

Rabbit anti-Shigella flexneri YECA Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal FADD Antibody (J1D2) [DyLight 550]
NBP1-04288R 0.1 mL

Mouse Monoclonal FADD Antibody (J1D2) [DyLight 550]

Sign In for Pricing
View Details
ATP6V1H Protein Lysate
OCOA20361-20UG 20 µg

ATP6V1H Protein Lysate

Sign In for Pricing
View Details
ELISA kit for Pig Cytochrome b-245 light chain (CYBA)
KTE80169-01 48 Tests

ELISA kit for Pig Cytochrome b-245 light chain (CYBA)

Sign In for Pricing
View Details
ELISA kit for Pig Cytochrome b-245 light chain (CYBA)
KTE80169-02 96 Tests

ELISA kit for Pig Cytochrome b-245 light chain (CYBA)

Sign In for Pricing
View Details
ELISA kit for Pig Cytochrome b-245 light chain (CYBA)
KTE80169-03 5x 96 Well

ELISA kit for Pig Cytochrome b-245 light chain (CYBA)

Sign In for Pricing
View Details