Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2G2 Rabbit Polyclonal Antibody (FITC)

OR2G2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OR1-32

UniProt

Q8NGZ5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OR2G2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VTIFYGTIIFMYLQPAKSRSRDQGKFVSLFYTVVTRMLNPLIYTLRIKEV

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

NCBI Accession Number

NP_001001915

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC20 Human shRNA Plasmid Kit (Locus ID 991)
TL314055 1 Kit

CDC20 Human shRNA Plasmid Kit (Locus ID 991)

Sign In for Pricing
View Details
Mouse Pcif1 Pre-designed siRNA Set A
SI110226A 1 Each

Mouse Pcif1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse Monoclonal ZAP70 Antibody (SPM362) [CoraFluor 1]
NBP3-11487CL1 0.1 mL

Mouse Monoclonal ZAP70 Antibody (SPM362) [CoraFluor 1]

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans R06F6.8 Polyclonal Antibody
MBS7186589 Inquire

Rabbit anti-Caenorhabditis elegans R06F6.8 Polyclonal Antibody

Sign In for Pricing
View Details
SCMH1 AAV siRNA Pooled Vector
43170161 1.0 µg

SCMH1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
CBP (C-1) Alexa Fluor® 647
sc-7300 AF647 200 µg/mL

CBP (C-1) Alexa Fluor® 647

Sign In for Pricing
View Details