Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2H2 Rabbit Polyclonal Antibody (Biotin)

OR2H2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FAT11, OLFR2, OR2H3, OLFR42B, hs6M1-12, dJ271M21.2

UniProt

O95918

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OR2H2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FCPDRQVDDFVCEVPALIRLSCEDTSYNEIQVAVASVFILVVPLSLILVS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_009091

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPRG Protein Vector (Rat) (pPM-C-His)
PV297321 500 ng

PTPRG Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Otenabant (Hydrochloride)
HY-10871A 1 Each

Otenabant (Hydrochloride)

Sign In for Pricing
View Details
EHD4 (EH-Domain Containing 4, PAST4) (MaxLight 550)
MBS6216662-01 0.1 mL

EHD4 (EH-Domain Containing 4, PAST4) (MaxLight 550)

Sign In for Pricing
View Details
EHD4 (EH-Domain Containing 4, PAST4) (MaxLight 550)
MBS6216662-02 5x 0.1 mL

EHD4 (EH-Domain Containing 4, PAST4) (MaxLight 550)

Sign In for Pricing
View Details
Parathyroid Hormone Related Peptide, aa107-111 (Parathyroid Hormone-related Protein, PTHrP, PTH-rP, Humoral Hypercalcemia of Malignancy, HHM, MGC14611, Osteostatin, Parathyroid Hormone-like Hormone, PTHLH, Parathyroid Hormone-like Protein, Parathyroid Hor
MBS6012732-01 0.02 mL

Parathyroid Hormone Related Peptide, aa107-111 (Parathyroid Hormone-related Protein, PTHrP, PTH-rP, Humoral Hypercalcemia of Malignancy, HHM, MGC14611, Osteostatin, Parathyroid Hormone-like Hormone, PTHLH, Parathyroid Hormone-like Protein, Parathyroid Hor

Sign In for Pricing
View Details
Parathyroid Hormone Related Peptide, aa107-111 (Parathyroid Hormone-related Protein, PTHrP, PTH-rP, Humoral Hypercalcemia of Malignancy, HHM, MGC14611, Osteostatin, Parathyroid Hormone-like Hormone, PTHLH, Parathyroid Hormone-like Protein, Parathyroid Hor
MBS6012732-02 0.1 mL

Parathyroid Hormone Related Peptide, aa107-111 (Parathyroid Hormone-related Protein, PTHrP, PTH-rP, Humoral Hypercalcemia of Malignancy, HHM, MGC14611, Osteostatin, Parathyroid Hormone-like Hormone, PTHLH, Parathyroid Hormone-like Protein, Parathyroid Hor

Sign In for Pricing
View Details