Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2H2 Rabbit Polyclonal Antibody (HRP)

OR2H2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FAT11, OLFR2, OR2H3, OLFR42B, hs6M1-12, dJ271M21.2

UniProt

O95918

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OR2H2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FCPDRQVDDFVCEVPALIRLSCEDTSYNEIQVAVASVFILVVPLSLILVS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_009091

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mark1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7120204 1.0 µg DNA

Mark1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Mast3 3'UTR GFP Stable Cell Line
TU162935 1.0 mL

Mast3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CD59 (CD59 Glycoprotein, 1F5 Antigen, 20kD Homologous Restriction Factor, HRF-20, HRF20, MAC-inhibitory Protein, MAC-IP, MEM43 Antigen, Membrane Attack Complex Inhibition Factor, MACIF, Membrane Inhibitor of Reactive Lysis, MIRL, Protectin, MIC11, MIN1, MIN2, MIN3, MSK21) (MaxLight 405) discontinued
137769-ML405 100 µL

CD59 (CD59 Glycoprotein, 1F5 Antigen, 20kD Homologous Restriction Factor, HRF-20, HRF20, MAC-inhibitory Protein, MAC-IP, MEM43 Antigen, Membrane Attack Complex Inhibition Factor, MACIF, Membrane Inhibitor of Reactive Lysis, MIRL, Protectin, MIC11, MIN1, MIN2, MIN3, MSK21) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Shewanella halifaxensis DNA-directed RNA polymerase subunit beta'(rpoC), partial
MBS1161903 Inquire

Recombinant Shewanella halifaxensis DNA-directed RNA polymerase subunit beta'(rpoC), partial

Sign In for Pricing
View Details
GENLISA™ Human 1-phosphatidylinositol-4, 5-bisphosphate phosphodiesterase Beta-1 (PLCB1) ELISA
KBH4871 1x 96 Well

GENLISA™ Human 1-phosphatidylinositol-4, 5-bisphosphate phosphodiesterase Beta-1 (PLCB1) ELISA

Sign In for Pricing
View Details
AJAP1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV651652 1.0 µg DNA

AJAP1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details