Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CANX Rabbit Polyclonal Antibody (HRP)

CANX Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CNX, P90, IP90

UniProt

P27824

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CANX

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVK

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001737

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLLT4 Polyclonal Antibody
MBS2574827-01 0.06 mL

MLLT4 Polyclonal Antibody

Sign In for Pricing
View Details
MLLT4 Polyclonal Antibody
MBS2574827-02 0.12 mL

MLLT4 Polyclonal Antibody

Sign In for Pricing
View Details
MLLT4 Polyclonal Antibody
MBS2574827-03 0.2 mL

MLLT4 Polyclonal Antibody

Sign In for Pricing
View Details
MLLT4 Polyclonal Antibody
MBS2574827-04 5x 0.2 mL

MLLT4 Polyclonal Antibody

Sign In for Pricing
View Details
Human Dipeptidyl Peptidase 10 (DPP10) ELISA Kit
MBS2019365-01 24 Strip Well

Human Dipeptidyl Peptidase 10 (DPP10) ELISA Kit

Sign In for Pricing
View Details
Human Dipeptidyl Peptidase 10 (DPP10) ELISA Kit
MBS2019365-02 48 Well

Human Dipeptidyl Peptidase 10 (DPP10) ELISA Kit

Sign In for Pricing
View Details