Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DGKG Rabbit Polyclonal Antibody (HRP)

DGKG Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DAGK3, DGK-GAMMA

UniProt

P49619

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DGKG

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KLLPMQVDGEPWMQPCCTIKITHKNQAPMMMGPPQKSSFFSLRRKSRSKD

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

82 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human C9orf78 shRNA (UAS) - Lentiviral human C9orf78 shRNA (UAS) plasmid
GTR15093475 1 Vial

Lentiviral human C9orf78 shRNA (UAS) - Lentiviral human C9orf78 shRNA (UAS) plasmid

Sign In for Pricing
View Details
FAM75D3 Protein Vector (Mouse) (pPB-N-His)
PV178131 500 ng

FAM75D3 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
PLV3-U6-ALDH3A1-shRNA2-Puro Plasmid
PVT82577 2 µg

PLV3-U6-ALDH3A1-shRNA2-Puro Plasmid

Sign In for Pricing
View Details
Nefazodone hydrochloride
C10984 10 mg

Nefazodone hydrochloride

Sign In for Pricing
View Details
STAC2, NT (STAC2, SH3 and cysteine-rich domain-containing protein 2, 24b2/STAC2, Src homology 3 and cysteine-rich domain-containing protein 2) (MaxLight 405)
MBS6351647-01 0.1 mL

STAC2, NT (STAC2, SH3 and cysteine-rich domain-containing protein 2, 24b2/STAC2, Src homology 3 and cysteine-rich domain-containing protein 2) (MaxLight 405)

Sign In for Pricing
View Details
STAC2, NT (STAC2, SH3 and cysteine-rich domain-containing protein 2, 24b2/STAC2, Src homology 3 and cysteine-rich domain-containing protein 2) (MaxLight 405)
MBS6351647-02 5x 0.1 mL

STAC2, NT (STAC2, SH3 and cysteine-rich domain-containing protein 2, 24b2/STAC2, Src homology 3 and cysteine-rich domain-containing protein 2) (MaxLight 405)

Sign In for Pricing
View Details