Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT3 Rabbit Polyclonal Antibody (HRP)

KRT3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

K3, CK3, MECD2

UniProt

P12035

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KRT3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSSGFSGGSGFGSISGARYGVSGGGFSSASNRGGSIKFSQSSQSSQRYSR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_476429

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD3 epsilon/CD3E Antibody Picoband® Fluoro647 Conjugated
PB9093-Fluoro647 100 µg/Vial

Anti-CD3 epsilon/CD3E Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Mucin 16 (MUC16, MUC-16, CA125, CA-125, Cancer Antigen 125, FLJ14303, Mucin 16 Cell Surface Associated, Cancer-related Tumor Marker CA125, Ovarian Carcinoma Antigen CA125) (APC)
MBS6269023-01 0.1 mL

Mucin 16 (MUC16, MUC-16, CA125, CA-125, Cancer Antigen 125, FLJ14303, Mucin 16 Cell Surface Associated, Cancer-related Tumor Marker CA125, Ovarian Carcinoma Antigen CA125) (APC)

Sign In for Pricing
View Details
Mucin 16 (MUC16, MUC-16, CA125, CA-125, Cancer Antigen 125, FLJ14303, Mucin 16 Cell Surface Associated, Cancer-related Tumor Marker CA125, Ovarian Carcinoma Antigen CA125) (APC)
MBS6269023-02 5x 0.1 mL

Mucin 16 (MUC16, MUC-16, CA125, CA-125, Cancer Antigen 125, FLJ14303, Mucin 16 Cell Surface Associated, Cancer-related Tumor Marker CA125, Ovarian Carcinoma Antigen CA125) (APC)

Sign In for Pricing
View Details
Anti-Human CD14 Nanobody (SAA2077)
HY038033-01 50 µg

Anti-Human CD14 Nanobody (SAA2077)

Sign In for Pricing
View Details
Anti-Human CD14 Nanobody (SAA2077)
HY038033-02 100 µg

Anti-Human CD14 Nanobody (SAA2077)

Sign In for Pricing
View Details
Anti-Human CD14 Nanobody (SAA2077)
HY038033-03 1 mg

Anti-Human CD14 Nanobody (SAA2077)

Sign In for Pricing
View Details