Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ablim1 Rabbit Polyclonal Antibody (Biotin)

Ablim1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Lim, abL, abLI, Limab1, AV079770, AW060987, AW215784, mKIAA0059, 2210411C18Rik, 2610209L21Rik, 4833406P10Rik, 9330196J19Rik

UniProt

E9Q030

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KAIYDIERPDLITYEPFYTSGYEDKQERQSLGESPRTLSPTPSAEGYQDV

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001096648

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cavin1 Pre-designed siRNA Set B
SI202030B 1 Each

Rat Cavin1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Rabbit anti-Mouse WD repeat-containing and planar cell polarity effector protein fritz homolog polyclonal Antibody, HRP conjugated
MBS1488831-01 0.05 mg

Rabbit anti-Mouse WD repeat-containing and planar cell polarity effector protein fritz homolog polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-Mouse WD repeat-containing and planar cell polarity effector protein fritz homolog polyclonal Antibody, HRP conjugated
MBS1488831-02 0.1 mg

Rabbit anti-Mouse WD repeat-containing and planar cell polarity effector protein fritz homolog polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-Mouse WD repeat-containing and planar cell polarity effector protein fritz homolog polyclonal Antibody, HRP conjugated
MBS1488831-03 5x 0.1 mg

Rabbit anti-Mouse WD repeat-containing and planar cell polarity effector protein fritz homolog polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Collagen 3 Polyclonal Antibody, APC-Cy7 Conjugated
bs-0948R-APC-Cy7 100 µL

Collagen 3 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
ML-SA5
C03610-5mg 5 mg

ML-SA5

Sign In for Pricing
View Details