Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ablim1 Rabbit Polyclonal Antibody (Biotin)

Ablim1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Lim, abL, abLI, Limab1, AV079770, AW060987, AW215784, mKIAA0059, 2210411C18Rik, 2610209L21Rik, 4833406P10Rik, 9330196J19Rik

UniProt

E9Q030

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KAIYDIERPDLITYEPFYTSGYEDKQERQSLGESPRTLSPTPSAEGYQDV

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001096648

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPB-GFP (Bsd) Lentivirus
LVP1025-B 1x 10^7 IFU/mL - 200 μL

SPB-GFP (Bsd) Lentivirus

Sign In for Pricing
View Details
Rabbit Monoclonal AKT1/2/3 Antibody (SR2003)
NBP3-22614-100ul 100 µL

Rabbit Monoclonal AKT1/2/3 Antibody (SR2003)

Sign In for Pricing
View Details
SNRPD2P CRISPRa sgRNA lentivector (set of three targets)(Human)
67609121 3x 1.0µg DNA

SNRPD2P CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
TNF Receptor-associated factor 5 (TRAF5)
337430-01 50 µL

TNF Receptor-associated factor 5 (TRAF5)

Sign In for Pricing
View Details
TNF Receptor-associated factor 5 (TRAF5)
337430-02 100 µL

TNF Receptor-associated factor 5 (TRAF5)

Sign In for Pricing
View Details
DNA fragmentation factor subunit beta (DFFB) Antibody (Biotin)
abx341674-01 50 µL

DNA fragmentation factor subunit beta (DFFB) Antibody (Biotin)

Sign In for Pricing
View Details