Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Opn1mw Rabbit Polyclonal Antibody (Biotin)

Opn1mw Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Gc, ML, Op, Gcp, Rsvp, Opn1lw, ML-opsin

UniProt

O35599

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVFAYCLCWGPYTFF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032132

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tas2r138 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
46172124 3x 1.0µg DNA

Tas2r138 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Lentiviral mouse R3hcc1 shRNA (UAS) - Lentiviral mouse R3hcc1 shRNA (UAS, iRFP) plasmid
GTR15267004 1 Vial

Lentiviral mouse R3hcc1 shRNA (UAS) - Lentiviral mouse R3hcc1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Slc9a3r2 (BC070458) Mouse Tagged Lenti ORF Clone
MR204526L4 10 µg

Slc9a3r2 (BC070458) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TKT antibody
FNab08938 100 µg

TKT antibody

Sign In for Pricing
View Details
LIMK2 Peptide
DF7327-BP 1 mg

LIMK2 Peptide

Sign In for Pricing
View Details
Olfr811 CRISPR Activation Plasmid (m)
sc-434682-ACT 20 µg

Olfr811 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details