Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Opn1mw Rabbit Polyclonal Antibody (HRP)

Opn1mw Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gc, ML, Op, Gcp, Rsvp, Opn1lw, ML-opsin

UniProt

O35599

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVFAYCLCWGPYTFF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032132

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fzd9 3'UTR Luciferase Stable Cell Line
TU204863 1.0 mL

Fzd9 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
3- (4-Fluorobenzyl) Pyrrolidine Hydrochloride
sc-472358 100 mg

3- (4-Fluorobenzyl) Pyrrolidine Hydrochloride

Sign In for Pricing
View Details
FIBIN Antibody
CSB-PA851526LA01HU-01 50 µg

FIBIN Antibody

Sign In for Pricing
View Details
FIBIN Antibody
CSB-PA851526LA01HU-02 100 µg

FIBIN Antibody

Sign In for Pricing
View Details
C6ORF106 Peptide - middle region
MBS3247559-01 0.1 mg

C6ORF106 Peptide - middle region

Sign In for Pricing
View Details
C6ORF106 Peptide - middle region
MBS3247559-02 5x 0.1 mg

C6ORF106 Peptide - middle region

Sign In for Pricing
View Details