Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aldh1a2 Rabbit Polyclonal Antibody (Biotin)

Aldh1a2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ral, Aldh, Raldh1, Raldh2, Aldh1a7, AV116159

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Aldh1a2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ALMVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033048

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal MMP9 / Gelatinase B Antibody
AMM01766G 10.05ml

Monoclonal MMP9 / Gelatinase B Antibody

Sign In for Pricing
View Details
Vascular Endothelial Growth Factor A (VEGFA) Antibody Pair
abx370216-01 5x 96 Tests

Vascular Endothelial Growth Factor A (VEGFA) Antibody Pair

Sign In for Pricing
View Details
Vascular Endothelial Growth Factor A (VEGFA) Antibody Pair
abx370216-02 10x 96 Tests

Vascular Endothelial Growth Factor A (VEGFA) Antibody Pair

Sign In for Pricing
View Details
SKF 83566 hydrobromide
sc-361360A 50 mg

SKF 83566 hydrobromide

Sign In for Pricing
View Details
Recombinant Human Integrin alpha 4 beta 7 Protein (His Tag)
MBS8126166-01 0.1 mg

Recombinant Human Integrin alpha 4 beta 7 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Integrin alpha 4 beta 7 Protein (His Tag)
MBS8126166-02 1 mg

Recombinant Human Integrin alpha 4 beta 7 Protein (His Tag)

Sign In for Pricing
View Details