Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aldh1a2 Rabbit Polyclonal Antibody (HRP)

Aldh1a2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ral, Aldh, Raldh1, Raldh2, Aldh1a7, AV116159

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Aldh1a2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ALMVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033048

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGBD5 Antibody
A74704-50UL 50 μL

PGBD5 Antibody

Sign In for Pricing
View Details
VPS41 (NM_014396) Human Over-expression Lysate
LH09156V 100 µg

VPS41 (NM_014396) Human Over-expression Lysate

Sign In for Pricing
View Details
MARCKS HDR Plasmid (h2)
sc-400837-HDR-2 20 µg

MARCKS HDR Plasmid (h2)

Sign In for Pricing
View Details
PSMD14 (NM_005805) Human Over-expression Lysate
LC401764 20 µg

PSMD14 (NM_005805) Human Over-expression Lysate

Sign In for Pricing
View Details
Kcnn4 ORF Vector (Mouse) (pORF)
25416015 1.0 µg DNA

Kcnn4 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mouse TCF7/TCF1 Alexa Fluor 750 Antibody (Clone 812145)
FAB8224S-100UG 100 µg

Mouse TCF7/TCF1 Alexa Fluor 750 Antibody (Clone 812145)

Sign In for Pricing
View Details