Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRAT Rabbit Polyclonal Antibody (Biotin)

LRAT Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LCA14

UniProt

O95237

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LRAT

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MKNPMLEVVSLLLEKLLLISNFTLFSSGAAGEDKGRNSFYETSSFHRGDV

Field of Research

Metabolism Research

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

NCBI Accession Number

NP_004735

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SYNPO2L Antibody [mFluor Violet 450 SE]
NBP2-82021MFV450 0.1 mL

Rabbit Polyclonal SYNPO2L Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Kcnh2 (NM_013569) Mouse Tagged ORF Clone
MR227000 10 µg

Kcnh2 (NM_013569) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Epimedonin G
orb1681066 5 mg

Epimedonin G

Sign In for Pricing
View Details
PIC 220-F-A4-B7527 AC Signs
808149 Card of 1 Pictogram(s)

PIC 220-F-A4-B7527 AC Signs

Sign In for Pricing
View Details
RBM15B (h) -PR
sc-78000-PR 10 µM - 20 µL

RBM15B (h) -PR

Sign In for Pricing
View Details
Scgb3a1 Mouse siRNA Oligo Duplex (Locus ID 68662)
SR401207 1 Kit

Scgb3a1 Mouse siRNA Oligo Duplex (Locus ID 68662)

Sign In for Pricing
View Details