Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRAT Rabbit Polyclonal Antibody (Biotin)

LRAT Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LCA14

UniProt

O95237

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LRAT

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MKNPMLEVVSLLLEKLLLISNFTLFSSGAAGEDKGRNSFYETSSFHRGDV

Field of Research

Metabolism Research

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

NCBI Accession Number

NP_004735

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Complement C3a Antibody (6E8) [Alexa Fluor 750]
NBP3-17998AF750 0.1 mL

Mouse Monoclonal Complement C3a Antibody (6E8) [Alexa Fluor 750]

Sign In for Pricing
View Details
Olfr1445 Lentiviral Activation Particles (m)
sc-434815-LAC 200 µL

Olfr1445 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Human SDC4 (Syndecan 4) ELISA Kit
MBS2506989-01 24 Tests

Human SDC4 (Syndecan 4) ELISA Kit

Sign In for Pricing
View Details
Human SDC4 (Syndecan 4) ELISA Kit
MBS2506989-02 48 Tests

Human SDC4 (Syndecan 4) ELISA Kit

Sign In for Pricing
View Details
Human SDC4 (Syndecan 4) ELISA Kit
MBS2506989-03 96 Tests

Human SDC4 (Syndecan 4) ELISA Kit

Sign In for Pricing
View Details
Human SDC4 (Syndecan 4) ELISA Kit
MBS2506989-04 5x 96 Tests

Human SDC4 (Syndecan 4) ELISA Kit

Sign In for Pricing
View Details