Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OPN3 Rabbit Polyclonal Antibody (HRP)

OPN3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ECPN, PPP1R116

UniProt

Q9H1Y3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OPN3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human

Tested Applications

WB

NCBI Accession Number

NP_055137

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome c - pigeon (88-104)
A1061-1 1 mg

Cytochrome c - pigeon (88-104)

Sign In for Pricing
View Details
Anti-Oncostatin M/OSM Antibody Picoband®, FITC Conjugate
PA1668-FITC 100 µg/Vial

Anti-Oncostatin M/OSM Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Lytechinus variegatus protein white-like Rabbit Polyclonal Antibody (Fluoro594)
orb3086437 200 µL

Lytechinus variegatus protein white-like Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Poly A Binding Protein Cytoplasmic 1 Like Protein (PABPC1L)
MBS2084957-01 0.1 mL

PE-Linked Polyclonal Antibody to Poly A Binding Protein Cytoplasmic 1 Like Protein (PABPC1L)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Poly A Binding Protein Cytoplasmic 1 Like Protein (PABPC1L)
MBS2084957-02 0.2 mL

PE-Linked Polyclonal Antibody to Poly A Binding Protein Cytoplasmic 1 Like Protein (PABPC1L)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Poly A Binding Protein Cytoplasmic 1 Like Protein (PABPC1L)
MBS2084957-03 0.5 mL

PE-Linked Polyclonal Antibody to Poly A Binding Protein Cytoplasmic 1 Like Protein (PABPC1L)

Sign In for Pricing
View Details