Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Opn3 Rabbit Polyclonal Antibody (FITC)

Opn3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

E, Ec, ERO, Ecpn

UniProt

Q9WUK7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AESEMHIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVEDSDRSS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_034228

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2orf84 AAV Vector (Human) (CMV)
14442101 1 µg

C2orf84 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
MAPKAPK2 Knockout AGS Polyclonal Cells
ARG2409 1 Million

MAPKAPK2 Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details
Rabbit anti-TRMTl Antibody, Affinity Purified
A304-205A 100 µg

Rabbit anti-TRMTl Antibody, Affinity Purified

Sign In for Pricing
View Details
NDFIP2 Human shRNA Plasmid Kit (Locus ID 54602)
TL303006 1 Kit

NDFIP2 Human shRNA Plasmid Kit (Locus ID 54602)

Sign In for Pricing
View Details
Lentiviral human UBE2K shRNA (UAS) - Lentiviral human UBE2K shRNA (UAS, RFP) plasmid
GTR15140017 1 Vial

Lentiviral human UBE2K shRNA (UAS) - Lentiviral human UBE2K shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Ccdc178 Mouse Gene Knockout Kit (CRISPR)
KN502692 1 Kit

Ccdc178 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details