Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2W1 Rabbit Polyclonal Antibody (Biotin)

OR2W1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Hs6M1-15

UniProt

Q9Y3N9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OR2W1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VVSMFYGTIIYMYLQPGNRASKDQGKFLTLFYTVITPSLNPLIYTLRNKD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_112165

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kindlin-2 (Fermitin family homolog 2, KIND2, Kindlin-2, MIG2, mig-2, MIG-2, Mitogen-inducible gene 2 protein, PH domain-containing family C member 1, Pleckstrin homology domain-containing family C member 1, PLEKHC1, UNC112, UNC112B, FERMT2) (AP) discontinued
K1778-AP 100 µL

Kindlin-2 (Fermitin family homolog 2, KIND2, Kindlin-2, MIG2, mig-2, MIG-2, Mitogen-inducible gene 2 protein, PH domain-containing family C member 1, Pleckstrin homology domain-containing family C member 1, PLEKHC1, UNC112, UNC112B, FERMT2) (AP) discontinued

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD3 Antibody[17A2]
FCE1579-01 25 µg

PerCP/Cyanine5.5 Anti-Mouse CD3 Antibody[17A2]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD3 Antibody[17A2]
FCE1579-02 100 µg

PerCP/Cyanine5.5 Anti-Mouse CD3 Antibody[17A2]

Sign In for Pricing
View Details
Rabbit Polyclonal Pyrethroid hydrolase Ces2e Antibody [DyLight 594]
NBP3-06082DL594 0.1 mL

Rabbit Polyclonal Pyrethroid hydrolase Ces2e Antibody [DyLight 594]

Sign In for Pricing
View Details
0.2 ml Flat Cap PCR Tube, Assorted, 1000 ea
TC2-02-A 1 Each

0.2 ml Flat Cap PCR Tube, Assorted, 1000 ea

Sign In for Pricing
View Details
TNNI3K sgRNA CRISPR Lentivector (Human) (Target 2)
K2419703 1.0 µg DNA

TNNI3K sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details