Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2W1 Rabbit Polyclonal Antibody (HRP)

OR2W1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hs6M1-15

UniProt

Q9Y3N9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VDTTTVEMSVFALGIIIVLTPLILILISYGYIAKAVLRTKSKASQRKAMN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_112165

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FLOT2 sgRNA gene knockout kit - Lentiviral human FLOT2 sgRNA gene knockout kit (100)
GTR15388921 1 Vial

Lentiviral human FLOT2 sgRNA gene knockout kit - Lentiviral human FLOT2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Rat Etfrf1 Pre-designed siRNA Set B
SI204614B 1 Each

Rat Etfrf1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
BMP7 (Bone Morphogenetic Protein 7, OP-1) (PE)
243830-PE 100 µL

BMP7 (Bone Morphogenetic Protein 7, OP-1) (PE)

Sign In for Pricing
View Details
Cpb2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
16741114 3x 1.0 µg

Cpb2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse monoclonal MAP2K4 antibody
MBS5306684-01 0.1 mL

Mouse monoclonal MAP2K4 antibody

Sign In for Pricing
View Details
Mouse monoclonal MAP2K4 antibody
MBS5306684-02 5x 0.1 mL

Mouse monoclonal MAP2K4 antibody

Sign In for Pricing
View Details