Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC19 Rabbit Polyclonal Antibody (HRP)

DNAJC19 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PAM18, TIM14, TIMM14

UniProt

Q96DA6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DNAJC19

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_660304

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

E3 Ubiquitin-Protein Ligase TRIM69 (TRIM69) Antibody
abx026604-01 80 µL

E3 Ubiquitin-Protein Ligase TRIM69 (TRIM69) Antibody

Sign In for Pricing
View Details
E3 Ubiquitin-Protein Ligase TRIM69 (TRIM69) Antibody
abx026604-02 400 µL

E3 Ubiquitin-Protein Ligase TRIM69 (TRIM69) Antibody

Sign In for Pricing
View Details
TBC1D21/TBC1 Domain Family Member 21 Rabbit pAb
E2862343 100 µL

TBC1D21/TBC1 Domain Family Member 21 Rabbit pAb

Sign In for Pricing
View Details
ATG3 Protein Lysate
OCOA08521-20UG 20 µg

ATG3 Protein Lysate

Sign In for Pricing
View Details
HRASLS Double Nickase Plasmid (m2)
sc-424228-NIC-2 20 µg

HRASLS Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
GPR174 sgRNA CRISPR Lentivector (Human) (Target 3)
K0899704 1.0 µg DNA

GPR174 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details