Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Olfr1386 Rabbit Polyclonal Antibody (Biotin)

Olfr1386 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MOR256-, MOR256-50

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LQPKSSYSESKGKFVALFYTIVTPMLNPLIYTLRNKDVKGALWKVLGRGT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001011741

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS16 Protein Vector (Rat) (pPM-C-His)
PV316001 500 ng

VPS16 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Phospho-ETS1 (Thr38) Rabbit Polyclonal Antibody (BF680)
orb2527809 100 µL

Phospho-ETS1 (Thr38) Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Bovine Complement C1S Subcomponent (C1S) ELISA Kit-Sandwich
EK12F230-01 48 Test

Bovine Complement C1S Subcomponent (C1S) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Bovine Complement C1S Subcomponent (C1S) ELISA Kit-Sandwich
EK12F230-02 96 Tests

Bovine Complement C1S Subcomponent (C1S) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Monkey COBW domain-containing protein 3 (CBWD3) ELISA Kit
MBS7223647-01 48 Well

Monkey COBW domain-containing protein 3 (CBWD3) ELISA Kit

Sign In for Pricing
View Details
Monkey COBW domain-containing protein 3 (CBWD3) ELISA Kit
MBS7223647-02 96 Well

Monkey COBW domain-containing protein 3 (CBWD3) ELISA Kit

Sign In for Pricing
View Details