Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OPN5 Rabbit Polyclonal Antibody (FITC)

OPN5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PGR12, GPR136, GRP136, TMEM13

UniProt

Q6U736

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OPN5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIH

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

NCBI Accession Number

NP_859528

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Defb34 Recombinant Protein (Mouse)
RP128642 100 µg

Defb34 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Human IP6K1 Pre-designed siRNA Set A
SI007725A 1 Each

Human IP6K1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Probable small nuclear ribonucleoprotein G (smg1)
MBS1168785-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Probable small nuclear ribonucleoprotein G (smg1)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Probable small nuclear ribonucleoprotein G (smg1)
MBS1168785-02 0.1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Probable small nuclear ribonucleoprotein G (smg1)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Probable small nuclear ribonucleoprotein G (smg1)
MBS1168785-03 0.02 mg (Yeast)

Recombinant Schizosaccharomyces pombe Probable small nuclear ribonucleoprotein G (smg1)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Probable small nuclear ribonucleoprotein G (smg1)
MBS1168785-04 0.1 mg (Yeast)

Recombinant Schizosaccharomyces pombe Probable small nuclear ribonucleoprotein G (smg1)

Sign In for Pricing
View Details