Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OPN5 Rabbit Polyclonal Antibody (HRP)

OPN5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PGR12, GPR136, GRP136, TMEM13

UniProt

Q6U736

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OPN5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIH

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

NCBI Accession Number

NP_859528

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Collagen Alpha 6 (IV) chain (COL4A6) ELISA Kit
GTR10325596 96 Well

Monkey Collagen Alpha 6 (IV) chain (COL4A6) ELISA Kit

Sign In for Pricing
View Details
FAM177A1
CSB-CL847607HU 10 μg Plasmid + 200 μL Glycerol

FAM177A1

Sign In for Pricing
View Details
Human PAGR1 Protein Lysate
MBS8416731-01 0.02 mg

Human PAGR1 Protein Lysate

Sign In for Pricing
View Details
Human PAGR1 Protein Lysate
MBS8416731-02 5x 0.02 mg

Human PAGR1 Protein Lysate

Sign In for Pricing
View Details
Rat Hepatocyte Growth Factor Activator (HGFAC) Protein
abx067073-01 10 µg

Rat Hepatocyte Growth Factor Activator (HGFAC) Protein

Sign In for Pricing
View Details
Rat Hepatocyte Growth Factor Activator (HGFAC) Protein
abx067073-02 50 µg

Rat Hepatocyte Growth Factor Activator (HGFAC) Protein

Sign In for Pricing
View Details