Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Olfr329-ps Rabbit Polyclonal Antibody (HRP)

Olfr329-ps Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Olfr3, MOR275, MOR275-6P, Olfr329-ps

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TVLRMNSAEGRKKALATCSSHMTVVTLFYGAAVYTYMLPASLHTPEKDMV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001011531

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBX4, NT (E3 SUMO-protein Ligase CBX4, Chromobox Protein Homolog 4, Polycomb 2 Homolog, Pc2, hPc2) (Biotin)
MBS6467798-01 0.2 mL

CBX4, NT (E3 SUMO-protein Ligase CBX4, Chromobox Protein Homolog 4, Polycomb 2 Homolog, Pc2, hPc2) (Biotin)

Sign In for Pricing
View Details
CBX4, NT (E3 SUMO-protein Ligase CBX4, Chromobox Protein Homolog 4, Polycomb 2 Homolog, Pc2, hPc2) (Biotin)
MBS6467798-02 5x 0.2 mL

CBX4, NT (E3 SUMO-protein Ligase CBX4, Chromobox Protein Homolog 4, Polycomb 2 Homolog, Pc2, hPc2) (Biotin)

Sign In for Pricing
View Details
VHL(Phospho Ser68) Polyclonal Antibody
JOT-AP15470-01 20 µL

VHL(Phospho Ser68) Polyclonal Antibody

Sign In for Pricing
View Details
VHL(Phospho Ser68) Polyclonal Antibody
JOT-AP15470-02 50 μL

VHL(Phospho Ser68) Polyclonal Antibody

Sign In for Pricing
View Details
VHL(Phospho Ser68) Polyclonal Antibody
JOT-AP15470-03 100 µL

VHL(Phospho Ser68) Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Exosc5 Pre-designed siRNA Set B
SI104519B 1 Each

Mouse Exosc5 Pre-designed siRNA Set B

Sign In for Pricing
View Details