Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2T29 Rabbit Polyclonal Antibody (FITC)

OR2T29 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q8NH02

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OR2T29

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GAAVYTYMLPSSYHTPEKDMMVSVFYTILTPVLNPLIYSLRNKDVMGALK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004694

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Snail Homolog ELISA Kit
MBS7258133-01 48 Well

Guinea Pig Snail Homolog ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Snail Homolog ELISA Kit
MBS7258133-02 96 Well

Guinea Pig Snail Homolog ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Snail Homolog ELISA Kit
MBS7258133-03 5x 96 Well

Guinea Pig Snail Homolog ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Snail Homolog ELISA Kit
MBS7258133-04 10x 96 Well

Guinea Pig Snail Homolog ELISA Kit

Sign In for Pricing
View Details
Bovine Bos d 11/CSN2 Rabbit Polyclonal Antibody
orb2950728-01 50 µg

Bovine Bos d 11/CSN2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bovine Bos d 11/CSN2 Rabbit Polyclonal Antibody
orb2950728-02 100 µg

Bovine Bos d 11/CSN2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details