Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CERKL Rabbit Polyclonal Antibody (FITC)

CERKL Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RP26

UniProt

Q49MI3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CERKL

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001025484

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FUT8 (NM_004480) Human Untagged Clone
SC109248 10 µg

FUT8 (NM_004480) Human Untagged Clone

Sign In for Pricing
View Details
Mouse Jak1 / Tyrosine-protein kinase JAK1 Recombinant Protein
R9729m 1 Each

Mouse Jak1 / Tyrosine-protein kinase JAK1 Recombinant Protein

Sign In for Pricing
View Details
Zfp738 Double Nickase Plasmid (m)
sc-436580-NIC 20 µg

Zfp738 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Rat Mammary Gland Total Protein Panel, set of any 15 Tissues
RT-414-015 15x 0.1 mg

Rat Mammary Gland Total Protein Panel, set of any 15 Tissues

Sign In for Pricing
View Details
CD177 (CD177 Antigen, Human Neutrophil Alloantigen 2a, HNA-2a, NB1 Glycoprotein, NB1 GP, PRV-1, Polycythemia Rubra Vera Protein 1, NB1, PRV1, UNQ595/PRO1181) (FITC)
MBS6372842-01 0.1 mL

CD177 (CD177 Antigen, Human Neutrophil Alloantigen 2a, HNA-2a, NB1 Glycoprotein, NB1 GP, PRV-1, Polycythemia Rubra Vera Protein 1, NB1, PRV1, UNQ595/PRO1181) (FITC)

Sign In for Pricing
View Details
CD177 (CD177 Antigen, Human Neutrophil Alloantigen 2a, HNA-2a, NB1 Glycoprotein, NB1 GP, PRV-1, Polycythemia Rubra Vera Protein 1, NB1, PRV1, UNQ595/PRO1181) (FITC)
MBS6372842-02 5x 0.1 mL

CD177 (CD177 Antigen, Human Neutrophil Alloantigen 2a, HNA-2a, NB1 Glycoprotein, NB1 GP, PRV-1, Polycythemia Rubra Vera Protein 1, NB1, PRV1, UNQ595/PRO1181) (FITC)

Sign In for Pricing
View Details